ELFa(4`H4 (444&&&&&DAAA /lib/ld-linux.so.2GNUCRNLQ7>=B,C ?J/AI' HMPD-G:+$0)K#!F9O@;61%  *. 3&4 (25E"<8 t@w&lDĎ.A7Ԏ<{s82y  $,4=D|B!T(F OB>dft9|VL E`\ ď<ԏtX%$zxz\ g` BB$|BU4,DtTdt4l@ BXjT Z{+ LĐnԐ\2<|B=@}$ 4DTd7tF{D &R đ ԑ(__gmon_start__libncurses.so.4tparmtgetnum_DYNAMICtgototgetflagechocharospeed_init__deregister_frame_infotputsfilterPCtgetent__divsi3metarefresh_fini_GLOBAL_OFFSET_TABLE___modsi3UP__data_starttgetstr__register_frame_infolibc.so.6strcpyioctlgetenv__strtol_internalfgetsmemcpyperrorputssystemmallocrmdirreaddirchownabortchmodrenamewritefprintfctimestrcatferrorreadstrncmpstrncpyunlinkrealloc_IO_getcsys_nerrstrncatmemsettimeopendirsys_errliststrcmpgetpwnamsprintffcloseaccess__xstat__errno_locationexitfopen_IO_putc_IO_stdin_used__libc_start_mainstrlenclosedirmkdirfree_etext_edata__bss_start__bss_start___end_bss_end____bss_end____end__GLIBC_2.1GLIBC_2.0ii ii APBB&B'B1DH@@@AAA AA A A A A$A(A,A0A4A8AA@ABACADAEAFAIAKALAMAOAQ -LJ{- t h \ P D 8 ,       ر ̱  崱 娱 圱 吱 儱 x l ` T H < 0 $      ܰ а İ 帰 嬰 堰 唰 到 | p d X L @ 4 (      -- 0i{xL - 0 0LS 鸮 0-X L0PSD0 R @000 0S000&& -L -0 LA. R2@̀`Pp( :`@GP U0 0 @0S$Y0P\ 4 iE0S<0 R 00@p000P@2 q, -L ,MD pP  P [ (|<|xUt0@T PK]M)%l ``K!KP@Tns`|@ -LM `P aA`P#$4|p0PU HKpK@  T @ Pp0U @  T @ Pp0U p-L`@ P0!0ƅ6P G)oPPp%@QP1P00P00Pp"P@0SP00p@ 0-@0L@PT  P%0@T0@ -Lp0`@T WP P00w0PT 0p@T@ 0-40L@PT @YT000@ -L`@@KP! <MAPpU @K AP  {|@K&]I -L4@K! $MxAP | -L 0-T0@LT DP JP 0%JP@T0@0 -< <00 00( (0(L000@qP -t0 L  \\ 0\ H R* 00R:00C000 0P p-LQ0%aPpp@p `PA1T  0p ^ w00w00C1@pbpAq hP@d !0R1 0p \ Aw0 0w001Aq\p@0 p-LPQ8@eTpQ0 p `Ppx!0 Wh1d1  @D0t  0p Q @Dt 0p Q0  w00w0p@0 p0 `P 0V00  PE0u  0 p0R PEu 0 p0R0  w00w0p@0qШ -LpQg0pGS44@G1P  0p ^' w00w00C1@Dta@Q1P  0p ^ w00w00C1@Dt@vPT0 ! p0Q3 0S0 0 R 0S 0R0R 0 0Q  0R 0S 0R0R 0  p0R 0S@@T vP 0 pSy0 w00w0@0$33 -LpQgY0pGSXT@G@YvPTT01 0 0 0p S. 0S+ 0 R 0S 0R0R 0 R 0S 0R0R 0 0p Q 0S a@Q1P  0p ^' w00w00C1@Dt`@P1P  0p ^ w00w00C1@Dt@T uP  0 p0Q1p w00w0@0$33 -LP 01 ,1u(!`\\"\ lQ A0q @ Aq 0p \ w0 0w0Lh0| @ \ 0L| 0 p0R w0 @T440 -L`p0PV 00 S d@QS0SS,0 PP0`V5 -P@ 1LS 0   P 1S10C1@ -X@ 1LS 0   P 0 1Q01@ p-L@Qd6pp@Dt d`dP1P  0p ^ w00w00C1@Dtp@0 p-L@QdZpP  p0 `Pp 0pT00  @D0t 0p \ @Dt 0p \0 D w00w0hp@0qШ -LP Qa0 0u `\QA` q0 TAq 0p \ w0 0w0@T440 -404 Lpw00w001 0@ -L0 01@ -000 Lpw0 0w00@ -0 L !@ p-L`PMPKh l=@T T/"^4 40p0 01N ,||0@p -LPQ00P 0c AT  @w0T !0w0 @| -LPQ000c( 0T @| -LPQ<0040 c 0T0! |@ 0-LPQ000` cQ@T 0 @T @A0w00w00 0@| -L|PM <PPpW l!0@S\<X1,PaP1LU D1U U U0pSxK!<U U U@0R0S)@0 SU0p U0pU0p @0`S@0S 0S`V 00PL0T:D=t}}4d},dlpld7 5$5D5@}p00P@```0U0 ppl(5,5 -LPK~ @pKMC<`VFl@K[00K pP! PT<p 0@S 0S 0S@T 00p(0R : }}}d}d7@}P00p @@@ 0-L @0PS4 Q,0S)0B S0S 0S\ 0S 0SA00 8C8S  S00  0S0d7 -LXM | , VP P m~~TTf0S> xpK n |0PS P* B0 S `R 0RU0  PU DPP@0 SU @@ DP0SL1`VG 1[SAx@Ka(P|0pSP1 @0 S R0SU0  PU CPP@0 SYd CPvU @@CPl`V l8~T-d74| -L`0S 0\S:S /S/P 0SQ \P PA@_\m/PT/f/PM/耟@P$ 0S! P0S:S  0S:S\ 0\/S/0000/@/P 0:Q@ RPp@0!1 B`0`` nP0 L 0S0000 0.000@Dtp&&vxQ -X0LPL P@0P8 P_@^PP_J%J -ALD`P05B`0P+B0`V! `@P BPPP0 0dpPp0A `@PB00pP0A `V,EE p- 1L@1@ T!Q0`S @ 0Pp 0Q 0 $  p0 RT^!@D T^IppTT^@$pQ0@ç000p5E555,7 -LpP+PLW(1 RF 1a@T Pw0S Cw 0S w0 wPvP@Tcw0 w0 0@w@0S X0 @5 <0< 80 a ,5z@4,4p5 -1uLw Q p W@ 0T a p0T  p W@TU p0TL1 vpR# w0 @ 0Pp`T& T T@UP U T0$UT  T Up WpG WpJ ppCpJp @W 0p Q XPpWZP$W@ 0p Qw0@00w044, -l3MLPX0 100 S00P0S,  `Pp0 @p0U40 Y ,U "0 0T M Ƞ0 U00 0T < L <, T \0X 0T L Ƞ0 T 00 0T < L <U 4 UPP`T @40pGT@ (B( 8C8srTUZ0?S}tx!0up0SpXZs X  (00SR0 !Ƞ"!0t`P0VS 8C8 (B80 V00V\5 @0  ~L 1V18 V0!d 0| 0b0| 00b00 4 00a0!00a0 07@4E5T0P00!40UP40t ` V0 w00w0E@ -Pt` 0LU P`U 0 00`|000c0 @T p0@Tx0! 0x y00 0 S @ @0S0 0S0 00E555, -!Mpt`uL, |00, t0Q 0V, K@@1!0400,10!!0`0c0 p0 0 W 0@T PN0@Tp0S00x0! 0y000 S1 X X0S0 0S0t0, 0`0V00545E,5 -AaLt00P \ 000 0\pF0| bPpQ |Q000 b| 000|0w  w Q0Q 0 0CR#P00`0|0w 0|0 w 0 0CR0 0CR@0 000 0@p,44E5 -1MpLWm 1u t`R0V, Ud0!G L1 HW 0X40 0CR9 |0!0@`0c00T P0 j0@0T0 S  @ 0S0 0S0lX00!000000t0,  `0VpWz4E@,p555 -LP0@\- p`܀ !000 !00 !000 0 !p 1R 0 R 000P0\8, ,000r,EE4444 -LM, 7,p0 0CRpp Z{ t!t1 @`G0 \ P@T,$!((0 S1  @ 0S0 0S00! 0 0000!00!Q0 p0 003x_T,h0 R , P P0P  8L44,55E4444D ,0p 0CPppQp,p0ZWL ,H0 R + P 000 00,444DL4 - 1 Q@L`0!1@`@@0| 0@@ @d@ p `@0T P0@T0 S   P0S0 0S0< 00 00$  p,@5E555 -L0M80 0  040 0`, 0p@;V  0R `0V0  0R V PF< 0P< `0IA0  W0Tw@D0T4 Q W4 WR! GPDP p 0Q 0R  0 000 D"`00p(2LPQ 0R Q R0`000  0R000S p0V0#00S 000w4 PRd1 R W 0W SPEU 0U S 0eSP, SV 0@ S0Y@@80T D8@ (0000  V0 U/ 0@ S0Y@@8 T T0D8@ T8 0R@ ( 0R,84 5P4V 00 0V0 80P 00 D, -L1M R. t0u `0 00!!000 00!`0 pX=  0 R-  4! 0 #40 *40 <> 4E,5@5<44y4wJOK84S0 (K 3` PR 0SNK01[S 52 R 0X 0l|0S X|<42 R 0X  GBp@a?81 IKI 0S4 W Tp@ Th([ @P `P44 8!`@P `P 440`S @`PP `P@P `P `p0V4X 0`V(48<4 7@DHL4PTXX4\`, 0-LPd@KPM_#qP YK0T0Kd0 - 1  L` p\ 0R  00 R0 0L0P0 R4夠0@㔠0CTP (0@0CT 0R0\  0,00,5 5444844 --t2 LR `2`BLT2PH"P0pS,( 0R0\ ! 01! @`T ȁ%T 0 0S(T[g@D0D4SJ H1D-@) z%"L0 0S(T 0@0 44,4845 5650\ S0C0000@T~80S4,0 005844 -LР@P̀Pp @d0-` 0S(0`0P 0` 0S@(T 0@ ,0R0B0000 5,6&5 -L̠@PȀPp @d0-` 0S(0`0P 00@ 0S(T 0@ (0R0B0000 5,65 -LD 2?bc11aB w.@0p 0S(0@0 P R&/C1b0@(T 0@ 0R0B0 t R&C1h10F0@(T 0@ 00R0B0000Q 5,6gfff5 -L 0-`0``@`L0 S 1 P 0S0 0S005E,5 -0 L55 -L(@v, , 0- @LP00P04h 0-@LP00P04 0- @LP00P04h -\0LX @ R(T 0 0@00 R0B0 5,65 -P@LT p`ppp0 0S(T 0@0440 R0B0@0T00 5,65 -L00, P0Q 005 5, 0-l0lP@L 10S0 ^0PS 1, 01010A@000H,4 -LPh `0pUT0 A0 V P ,0!0PU,EE -(0 LR w00w0 Rz -(0 LR w00w0 Rz -L@KeMM@ mKs]K⼓ *0AQ:0S/SQ1+|(p Q:0/S AQ:0/S Q * .00/  .0C0 0000 S S 0S  0S 0S 0S2[S|"|2 (K  KVP @B <4xp0 B wl G^KPEPEAa^GKAA K,P` P A |SP PpBd>WNK@D@DGKAA2K/WKAA KPG d`P@ %@P  @@PP  ? EFElpGtĀ`P|A xpp_NK@D@D v 0A @Pq00@P0: S 0 S S S _NK@D@D _K@@@  @P0: S 0 S S S _NK@D@D b_K@@b@ Gt 8< @P0: S 0 S S S _KAAblG -L@JKM9@_KKBnK`FRKHԡ *0AQ:0S/S Q1  Q: 0/S AQ:0/SP!Q *.00/  .0C0 0000S S 0Seb 0S 0S 0SU(2[S 0 (K GDh`;DJK@P  EEFlp@HD -L@0@ *0@P:0S/SP1 -L@0 DP :0/S  @P:0/SP *.00/  .0C0000S S 0SE -L@@0S 0S00SFl -L@F@  @P0: S 0 S S S  p-L@M 2 0&PucA0SژKP0S FKP0SfKP1U $ D P d     , T d      H d       0    4 @ t    @TlKx K K @FK @K P FK @P@[ K @FK|  }K>zKt uKo @FKl mKg @FKd $ eA[00Kx Pd T R@AKFK ,00FK@ GFK= @P K9  9K1d 5K/ @FK, T +Kg 'KQ "K @FK Tñ K @ TD8D0; (,33"E0 X(Hx6P"3  K K FK@KK9 K @FK Tr Kz FK @PKT@fK@D@ 2K @PT20 PI T0? K @PTp"00Q\1H2? FK @P K K `K 2@K PFK P @ qK,2JkFKe @PKT@dPY @KQ q NKFK9PFKFK1P>KFKe 9KFK$3KFK.K( @FK% `|&KFK|!K @FK oKK *PK KFKf/KH@80T 2p -L+P00ʅ0@T 0pW P`0S P 08 PP0pW@TL  -L`PBUp0@  PPD`U -L\ 0p񟗑$,4DL\p(4@H\dlt| $,8@ ,<LT\px $,4<DLlt|D2824202$2 :f2 2a11 y1 1 R o! 0jA9fx1|!0 R>d1ZTWTT@1<1< 01,1(1$1 10 |:1000000000 0+80 / q440xq@,54H55447 7(x2D4344507444,5IX55 21K1A1?1=XT111611 11|!0SC@\X(BPLH1 <814101,(1$1 11k1!000000`0 us000 047H445P4,`T45$3444`5I@x6H0555445(5q644l4@ H7457 p- 1 L!@`T1@p0 PR0R0^0 0SpP 01P  0^0 QPL 00^0 Aq00p8zJП -L`0M pR D0K R!PU YD0K@ 6 0@K 0 00sHBV 0K $`/!PU 64x2@K` q0 PR! 4P |@ xdP= 40 P(P5PĆ$5Ȇ p-0 M LR 80K p` PU >80KP@ `$@K 0$0s(4؆20 PR xP h@ d4)P&e 40 P(P[T5PĆ$5Ȇp p-0 M LR 80K p` PU >80KP@ `e$@K 0:$0s1(420 PR xxP h@ dP + 40 P(PT5P,Ć$5Ȇp -LPԑM, 0 0 %Sp $S p&S7 m\ 0z`v00bW 0`V @*PU @0`VUpUM Up1p0VF`VC 0X 0$ `V6 00iBiR 0nCnS0dCdSQ%@   d0P  @@P0  r v 0 L/2T000 , `00p0 -L`P0\  \ t0q `P B*M@Pg d@`P`\[SY!!!""("0"l"""""$#8#T#p#####$$`$$$$$$$$%%$%D%d%%%%))%%%%))&0&@&P&)`&|&)&&&&)&''))(')0'D'T'h''''''' ((()()$))P)`)l))))))<202$2F2B 2<1P0 000 k(1a1!w00w0x1x w00w0N# P U"!u;`P`Q`zQ@P@``+09Pu} l0l P3wT0rH0n<0j q440@xq5H4544CPUT R3M=;x#P|0|0 w00w0=H38<344y(3-3)PP&3P"w"P00oŸP002  BQ 22"tBT2WR$l:H`"P000S0042a(220(P`);P`"1UO`A0 B, ;,Y1Ux1Ql1vhd IT02C24@B!P000P`0'~t0H`x0s0o0k7 7(x@2D43445074,445,555 H445P4T45$3444@x60555445 A>0 0050/0*@0S pJ0mYP`hd `P0D0X80(56Ш4,44 H7457 p-@ LR08 00B S04!0BS/****** + + ++ + + + + + + + + + + + + + + + + + + + + +* 00 0 00000 0 SqH+P++,,,++,,,p1Pt  `APp01P OPPp}0S 0  00p0 Sp@`@aT@  *0} R t0l w0 0w0pppppppTL0K@0P -L AMP,  Pܠp` JK P0( K0A,$P[Xp0pWt d,$PT0( $K!4#1K!"K0S, (`-t&LTć̇dJKJKa0"DaR< y0B,QT 0"T  m j@T dJKa,JK$P0X" 0S @ P` 0,K2BJ 0 C,h$Pq`0X0SpW,L# -0L& -L0PT -0LT( -D0 LR4 (0S  R00,4T -L pp@ l@P@D`LL000/A!b0! @S0  lt-00l KDKgfff -L@P@D`DD000/A!b0! @S0  lt-00l ,Kgfff - L0P 0-LP0@S 0S0 0-LP0@S 0S0 -L@k0 CR :0S S S BR:0 S S 00 p-LP0`h@S 0 R \0e  R@0S00pK -L0 S S0 S S 0-S0 +R R 00B S100C -LP` -L ,PMK`P P btt@ppYpPK07K 0#P@1T4(#@TvK8TT(T 0-0 M LR40K hPdP ,40KL@ PI K 0 0s4X2L@@%00PuPpT0 -PpPPL@`0@,0bCS005A -LP9 00@ S!0@S/666777 7 7 77 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 76   -0L S S0 S S 0 +R-R 00B S.R  .R00A S.Q\ 0S 0 S S 0S -Lp`0S @P@P0S J@P0Sg0S - LFRTR0 S S0 S S 0-S0 +R R 00B S100C -LP 0SX 00L0 BR0S $ 0S0 ,4 p-L@P``P:pX -PLFH0 @0 <0  A0\$0L p-`LP 0PU @0TS @0PUp -L0Q B0Q p-L`0PU @0TS |@0PUp -L`pZMPK@ hP @P 00(@P 42 x[d -x1AM LRp`A`1 PKD1 `V ^^ P SAl`V 0HpP6KOK 0 (K  @P`0,l0 Pp 0HS`V 80`P442Шq|d45 0@P0000``P425 -L0 S S0 S S 0QH ~Q+0SC 0b0CS??????????>?>???>?> 0 0 00 000P BR0^ 0"S 0 S S 0 B"SR0Q ~Q0S0 Q -0MLPG Kp~ @K[00K @PPxZ0`b w0[SE@P UV00B42@202 Z0[`S ;S0 P44 -Mp L @P @P (4@04D0 R f&P&t&P4 -L0QM0  P 8AP?`V000 D 000@ PP`00@O@O `VT@ 0`Vi V0^d(pZ@KPK05,̋p0 p0 0 p0P 0 0Ppw`PP`VV P 000尐V㸚KX 000V8 000 W00Q Pp0Pp0  p0@ QT 1 \w00w0Q0S 000sVV 7܋ ,z0 0- L0P M 000@T0 p@Ph 0  T@PD @@T 0000008Hht  -L`p VM&3 R  P 0wS"00@0 PPP00@O@OPU(B Y7 `K0)KS 0SAQ 0Q/SV 00\ 0 R ;R@0g0@ P@ PDPU 1[0p @``@0p T  PP 0(1KP>0JOKVڈY& -KS-P`KPhd!up.H450, @P_\,Y0Uꬌ , -lAM 0L000T`V V4(}$1 @ PP`00@O@O`V Px嬀K0@K p `   0R T0pPUp0ČԌ5@ 00  ^ 0  0^pY`PP`Px0  0Q0 0PUH10V:K8 000V 000W w00w0  P 0 0 ! p @PU0 TL0 |Vl7@܋  -L0 S 0SAQ 0Q/S P 00 P 0 R ;R00 -X0 LR @P 4@T$0  5$40 -80@LT(|0P 5h -X0M LR NK4,wP P 0 @ 50(0@: 0000 -80@LT(;0P ]5P p-t0 LR p\%PPpHz`V 4@ 000p5 0 0-0 LR 0l0  u0TP H@0S <0 P60S 0  050\45@ 0- 00L@0P PP00#@O=@O3050 0-LEOK DM P% 0 bPP PyPrP @K{HP;P> 00 -`0@LT Ht0P @P $0 0005t@ -L@0S 0SQ 0Q00CS000 0q00 P -L@KP M0 R  A P 5 p`밀0 T PP0`Cp p P 0@T UTO I_K  P@C  4H$5D5,X 0@, -L@P$ ]P `1 pR P R 0R@`P0SPB00gC2K?cPV | 00 `R 0 0@S  V000P00 `Rd*0M0L 0-L 0MQ(PP Pg\_pKK, "00K5@T=0M0 0-L(@0 R T 0 0LPU 0S 0S P+@T P00L0M -Lp`PU00@T"00@ 40P  P_ -L`0M0PS @pT᐀!K0!0Kh![@T @PpTL@T0S @0S5Tm  P  -Ll1@TCX!XQ0`SP @0S00r9P@q 0@T8P p P@DT00 S R R p@ P ltT000D ``0S @_77Tm5 - LJ0P 鴍 -<@LP &00 0P 97Tm܍ -0L'(0P 0 0鴍Tm_ 0-L40M PR @K% $0 0S Tm0 p-L ` PP Ip@t00  P 0 Ƞ,Ƞ 0880P $+p`4 `T<_TL -L MM"P 9BKap1PJNK$&A0@00 S8Sʈm JNKp@DlQT `1\Pp H!00@T*PP@{T:tp0@@P `뀏̏,d `h* Bl*D<484L+PXmTP0, PD0.))  0 4P  l_B 0-LP P  P 0@0P00S S000S0Q  0wPU mSP 0 0ltp* -8q81 L  P !HaQ0 S P<P 90 S P0@T 4  x4 Ppp@x0R@ L 0 S P{P 4Ol*,, eh*T `4| p-0M LR 75FOK, `P. 0 `R'PK0@ S @0 S @ll @0PR 0R 0 0S0(000괐4, e,, dp p-1MPLU IFOK,D P`A @ PP 0 R 0S76P* x&P 8P P ,0 0 005(-zĐ@w00w0 R0p -0M LR eG` 0 R@JKp,@P8 _Kp`HD@@ P , "50Ȑ0-8-̐Аlh`D@P  @P 000 Tu@- -LpP@Ԁu P`J0/S  RJ0/S 00PJ0.SP 00PP 4@K 0 , f g h -L -LXM0&P,L0 )<d KPT0  : S h g -L@KM0 S S0000S S00 -L} -00 LR ?0P}5 -D0@LT d  Ph*T ` -4 40L@S  P, e 0-Ltt0 S \\ @0PR@ 0R 0 S00000, e,, d 0-D0L@ P@\L \ 0P00, f -< <M0LP KAP,,T -$$0 LRo , h -0 L00 d, -0<LP p dd0 S  wH0@T  m$$ l*, eh*T ` -(0 LUP  l* - 0LP  l* -80Lw,0$0P  r44l* -D D0L@P@ P  00 , f -L@P X0$L0P @ FT 0 00@7[l*D+H+ -@04LP 0 *((0 S  l*, e -@0<LP 0 ((0 S  l*, e 0-xPL0@T0\L0S 01LPP 0 0P  @0D+l* - 0-xPL0@T0\L0S 01PP 0 0hP  @0H+l* - -XM0LS 00 4  K P _T\ [ -LPM0S0 400 K Pn_T\ [ -LP  r -D0LQq 0S  < <0 -LŸM 0 \ xBPY  XL  P 4  $ P00 -#0  PP  U00 U@@T Q00P  R1 1 Px1,UU0S o mk04!0C0 0 0CyU0S) A[ YW0 0CS0  B  U 0 U  P``V( X X X XKHKS8KZ@0,0S0C RB4$h,0<$5, 5(50S0/SX3 p~RhP @K0` 0`SڈS 0 0CS0  B ʨ0[S P @0S S 00 0S0S@ @0S R 00 0S0[S+ 0S0C /R lR 0 0CS0  B 0C /R0[@S R 00 0S00C /R / /000 001,0SJ0/SXF`1 p$RA@K0 0u0`S,Qe ca0 0CS0  B @P 0S PO 00 0S00C /R /= |/000 00` ,?U2X X X K  K$hD 5,KYk X 00  0S  | 0Y l T U00\0SL 00 (  P( 0$00,>$hLT` 5, -LpM0@SO S, K쐟 `0V&0P P 0  P0 Q PU V`0 0  Q! XV,0S@ 0S00,4T-00(,0 , S -L@ U`P  Pp0,d P0ULp A P5 0PU4h,4T- -L`0@SD SA1p\" PP 1RP0a/S PU W pa?  0a/S\WZ@ 0S0000(,0S,4 -LP `P P`0,T0@pT a_ ~P @T4h,4 -L`M0pSS P@P% K ]PZKP 0KR7Q  0RPQp@PZ0@", x~RR @K00(00~S0 RZ000 S/R00,, -L@p F`P Pqd0,P00@P  P( @Pw3h, 0- L0PS0 Q*0 00CS0ڰ00000 0S0$@00p @0h S@ < X0@0, S0, 00@0555z4,D5 -LP @ 41,10SS@ L@P; 0PP @ 000SS@ L@`0@L0PuP r@ nH0k@0h0SS@ L@B0@K77lp -LPM8 < LP I@ Eh3B`3?0SS@ ̂< \*^ 00P\ 00 -#0  @@\ * R m",Z TTZU bPE|B 0R0C000C00 S<00C0 T0*0S  &1,T0*0S UȑA aAPE 0R0C000C00 S00C0U&h1 \0*0Sg  4@K40[S 8  apBU 1 R 00 P 0S,E8 0BUA@P 0T0T0S A| 0@@$00 T p0 R \1< 000, 0000,77$5,| 5(D54 -L@ 00P  p -L 00P   0-LP@ T <N}L{>yP TT^r@$pPl 0,0, -L@PPpL` 0S @T$Q@, p-LP@0M`\8 5ϼPT 0S [2@ P]+<)40V 0V  P?P; 4M@K1᥼0P @*P,ꠑ,p -LPPP@0   -LP =  0 -L P @ 00(0$0SS@" 77 p-L` @P0 p -LM@KHf40@T NTnT _  $5YTyT -40L @R 0S 0S4 -40L @R 0S ~0S4 -tLpslS0hcKdCM0ᴠ 00 00 8#0  10 $#0S3 ` G K Y"00`pŸ0TDPeT00T0S^ U U[  - P `2`R X2R P2R R @2R 82RR 2R 2RW ᜻p @ ` NH1R%1 Ru0BtS0h1B!0RPH崠D!0D10  K g ! yLOPpW}1AL1P5`X@ :@x 0PT) 0 TgL0 w00w0 00L-lhL4@4,5D5:,8!p"4,4$5!00L4 -q0M L P1`Q$0  8%P@@T* K$K D&I%@P!   "[w0!0w0P0S $ %P@@T K$K %&*%@P 0STF!V @Я $0@T0@, -1L R0A T 00z0 R 0pSڨ00@ T PP  t`R l0R @0 @RKL0A00 !L-h4lܑ,5pl -LP@P l餑 -L᛿?@P [餑 -L@ T 4 (0@@T0@Я, - 00 L0$0H-h, -, 0Ls 0$$H-,Xh -<1`LV# Q 0S00 0S0封 0PT@ p !0S00 p\Q`V0@Q } R0S0 0 `LP p !0S00 p\@Q0@ 0H4 -Lßp 0 @ W`3 ( }0S00 3P Q Ÿ 0Rw00w0QP" `p0V'1S 0P*@PPPT p0@` @R0 0 R,"0 @q0 0S00@v*PP@@U   0Q00 0Q00  0 00Q0P 0P  ^000 0 0 gQ  0qQ0` R 0 R0PU, P& 0S 0S  0P 1 Sڰ101@ !0ST 0 Sڱ000\PPU0H@ p-L@`P. R+ R-0 !0PR 0 Rp@Q 00CP@T , R00Sp@5( -$B0 L   00 s' 0001@P Q  0Rw00w0QP|1 q P)`P`ppV  00Q  0Q00   0 00Q0 0g0 `0`PZ( P" 0S` 0S1S `10g1@ 0ST 0S `00g0^PZ0H@ -T3M L,  Y 3 1S 0 P 2 10C12 2 pp0W 0j X X(0002P Q \ 0Rw0 0w0QPP , R P Ix}0 S001 0 \ Q A 0Rw00w0Q\00@PEP PL!0S81 @a&,0S T fP& @T0 @0 `h  0 00U00h0^! 0S1 S10h1! Rᰡα@1S T0 S00h0 RἠP^Y90@H4z2 1S 0 P X2 1I01@"0 p42p0 WZ 0iZ X-0001P Q  0Rw0 0w0QPP , R  P}0 S00$1 0 \ Q @ 0Rw00w0Q\00@Ph`EP P 0S0 10h1t0 P%T0 101, R TtPE T00@0`@0H4z  0 00T00h00 10h1^! 0S1 S10h1! Rᰡα@1S T0 S00h0 RἠP^Y@ -L`0 01O@T P@V 0S 0 %|0`pP0 SRPU0S`Us@θ@4 - C0 L  00 $2 p0 P`V0SIF0 0`RB 0 00P   0 00PX$ P 0SP 0S P1 01pT@ !0SP 0 \PX0 00 0Pҵ@&pP@@W  0 L  0 00Q0   0 00Q0p 0p  X- P' 0S Sp 0S p S p1 01T@ !0Sp Sp 0 \PXpn0@H -0L !P `0`pP0!@Q0TA (0!@@@08zП -LpP)HH0`!PR &@P F !0S@!01S@01@pp0 0  '0`!PR %@P 0x \@00\ L@0@000,1  B 8Пz -1M L \!0^1!0S 1 , 0000 L|k Td!0P 00RPR(1L`0@p0 S@ P0R00`L`V> 0 V p@P0 S@0PU00ZH `0!V00Q@PEu `0 S  08zP-45@ПZ@PE0u00 |<0S 0000 ,00045@Ш -H0 L 0 R  Br  B0r000@ -LP Q H DA00CS00P 1S Q8z -L`pᴳP$@PPPT R 00 Rp0 @p0  p0@p p0Q@ -Lp4`@P00S0p_@TZ 8L -LP@P 0S ll0 c"\0`pP0 SPU $0S`4 -L P0@100SP Q t pA00CS0 0\ 1S Q0 (0`*q8zP- 0-LPG$@P PP0O0 0-LP@ LPF0 -0} L0R00T0P Q 4 0Rw00w0QP0H 0-p0L !0PR 0 R<@Q 00CP0@5 - 0L0S0008 -L0P `R @T pPP 0@T0 S P P ~#0 @ P . 00C0`mpm`| 0-LMPP L `P <@Kk$hPꘒ0 0-L@KM⫲<P0 0PQ @0C꼒BB<0 p-dL0` 0CR0@@P0P0`L0 0CR0p`mpm -L0P  -L0MMD1 H1 P L pTq @ 3Xq p\q 3Pap8 3Pp\0 0 A !50UA@ B0  6P PP 00, ~0@pPP ,  0 0 00 j8 -L@ `p1T. 0 P P W' P PQ;0@ t 0S03S @0PP@ @1`V 0 0 P P W @57 -0 L  !0pR10C 1 q1 `!0C 11t@PP1  1011P 0qq0@ -,1L 0 @ s1P= RR \ppࠟ\ܐ)  @0封  `gXP0  0 S X0៥`>ͧ0  PᯪV 01000605@Ш -L1M L0 @ i(1Pe RQ  , QpP 0少 0 PY,0`c>VS0`P @fT? :`0  0 S S , @/@`v`05@`V0 PP,70ZⰑ 01 000Ш p-0 L0@ pT*T`  0p Q $pp0  hP0S0P 0 4 㖮P@Dtp0@2  -l!M0Lp @P0@ P ` R R GU0@ P R R `P0 {R``PA 0 @ R;0p KT @0S0p T \ 0 S S  0 0\ 0 S S~\P PV @0S c @05c0 `W -L!MP1`S SJ 0 0 S S<QZ]U )U }U{p[p(po@0 , %T !0R 0 ! 00S@S@D0  P T 0 ,ᰑC@ A 0 060  0 S S 0 @ᰑ"T}P 0PS @5 0`Pz` uT, -P1 L hZJzC 0 P0`U 0 S Sp S @Qឣ0``0PU0 S S P p@T P@PP  sP vPPJz0@5 p-0L P@ pT`dVpU 0 I 000pU X0 :H 000<0 +Pp0qШ -dL @0p` @1 010 W 1 1PP@P3T0 Pa,0 0@T0`P! 0pQ @T 0Ph0 @T 0Pa 0pQ @T 0EPb0qШ@ -LPQM \K@1\K\@K Uxt@K Pq [ @A0BS``R 0S @t Z V<1<1<@ V (1 x@1 y@ w0 0w04@p`0 ڡP7UZ 0 P00<0 P 00 0 P00<  P  0Z 040 040Zꤡȡ44@04X4@ TCԡ - pL0X ` 0`[V (V )V {V ]V }V )P}P]P (P {P[P0@@TZ ' !0R  ! 0 0R@ R@D P T 00 p封@ w00w0@, -L0`H 1 )V P(p }V[p{p@0 奦T0 R 㜦 !0R  ! 00 p \@0\@DQ1ST < 0`T 0@T0 㰑@, p-LP@,`ؠPp@TpH5 -L@`pT 0 P `PQS0@80 RP@€@PP@@`V57 -p L00S S - L2 - L0 0 @Q p0Q 0S0p Q0p Q 0SQ 0S P 0 0@ -L -L 0-t0L P@ |0Td^0U 00  000p00qШ -|0!LR#1 S J 0 0 S S RZ0CP#@ p-LP`@KLH M0 P VPUPePEu P(5p p-d0L `0P pU p@P@TPPp0 p-LP`@KLH M0 P VPUPePEu (P(5p 0-p0 M LP@ YU   @KݨTP PEu08 0 -L @0` 0pTT  P |PQ0@T0 RP@€@PP@@`VT0Ta@57 -L  -L -LQ  Q00 H08@0S `嵟0 ` 5 p-0 L NpP1QPPQ` 0 @e\  L \ L0 S S ᠤT-000p0Ш@ 0-LPK M@Tp 0 -0 M L C0KP?d00 02[1(0`0Cs(0 + 0p !0R0 ! 00@! 0P@#P Pҭ0    101(00Cs(0 0 㰡 -0 M L C0K8P?d00 02[1(0`0Cs(0 + 0p !0R0 ! 00@! 0P@ɭP P匭0   y 101(00Cs(0 0 㰡 -p M `L0P@T(KPj(0 0A 0"[0 0 S嵶Z@8\p0( 0S t0(0 @(0p0( p00 0} S} 0}P. T0 0<0,0@08w0[Q0w0 ,0 03[1 @pqDx0 0V,000  fP <00CS<0  ,0 P @ -`ML4 , 80 p0 R00 R<F  S   S< ,PK0@K ;P   ,PK0@K t&P`P0 00< Y00i0 '\ 0@PuI|!0D00 S 0\,01[ W`Z S ! 0W 0c1PS00SS,00 R S,00  0BPG 0 R8 ,00 9P2 < S,00  0.@P0 R ,00 %PS,K0K0 s@P 000lDl,K0K P < 000`0SE,0400 80 D -!Lȡ   y1`!? `S`FpW@ᖨPPg ɨPpWQ@01,!`Q000倨P ᴨ0000繙0 ⲙ< `0/`R`FpW@\PPg ᏨPpWQ@P0L `Q000FP z00000q v -4P4@ MLs P>-D47,0,0 0 K4K4 `0Vp0l pP0A 00J P  p P0`Vpqlll -L 0MX @#p0S i3S T0 R X`$0B:S񟗚x./////..//.////////////////.///////////////////////////L../`.TKX XX00`YT0 RP `Q00@`LTE HPE*R0<+R0<0;0@`8T`0T0  (R(!0 Q P0Kp@#0X0 匰)R WpG P0K!@ <R 0@0 >R @ RT TK@X T 0T0 P R X0SPW00 ,X0 ZX R @87vl<L@X J 5 0SPX 00X R "0S> P:  1 ; ŗ`? `S`FpW@PPg PpWQ@`Q000ҦP 0000$!ߗ1 !0SCP?  0  ႗`? `S`FpW@ᣦPPg ֦PpWQ@`Q000另P æ0000 圗0 vX -AaqL00B8S8C8S~Sy@0 S0@ S 8C8SiSd@0 S0P0`0AP U`P U$0$ 0v47l87 -L`0P<8C80CSMX444 581 0p@ P BpP ;@W@@3 @U@0@P+0 0%P! "@d0 0P@@إP  P@@@@\ -L @pP Ѱp ֖pP0[`^SP000@]Tڮ἖T -T \T @]T[V V- `VP@`@]TTTP 孮Ꮦ,p p-`M@0L0K PR% *0B?R S![R.R $R^R \R  (0B<RS>R R@0 0K  R *0B?RS\L@D\0[ 0 K0 0P87000D0Pp p-LP@Q`dVpHH SPOp(  IPp -L0S0P -LR 0QD0 p0QQ0 p0Q0 0-d0 L0P @ ٤P PҤP @U0@ -pM L$ ` @0R 0 Q( P K$ KP $ 0R< 0 Q Pa K$ K}P$ 0R< 0 Q$00   0-L@PQeM0  P0 -LpM4 08 ,0 `0\00 ; ,K0KV, 0  0R  0 R  B 00  P0@ =P aP6P Z@UP \,0400 8 @ -LP@0ڌ0 p \00cSC\ 00cS ^ 40 p0 \ ^0 -L@R 0\ 0 \ L 0  -LpP@M `K0 9@T x 000W T0S@T40 0@?W (5q@@ -L0S0 10 -L  ᶔ @pP;0PUpZpGPU@_P`e ᒣ`PUa@pQ000KP 0000 -1$ML, 00  , 0R`oV`1 \XXqcPU@A <[PU 00 !0{"0Pv<Ppғ04 `@ D 1 R  8 , @0 R000 p R0p SM X h0 X0S 0 @  00@̣L4,<@87v \0P% 0 4 p0 P4 X< !C0S V⇫0JrS񟗰DDDDDDDDDDDDDDDDDDDDDDDDD HOSTrCan not read lock file@ at could not remove lock fileyposyankflagxposwritehookwraphookwlinewcharsvscrlbarversionundoflagtpausetimeflagtimetargetstermstatussscrollssavesressofttabseedsearchpntsearchscrnamervalreplaceregionreadhookramprognameposflagpopwaitpopflagpendingparaleadpalettepagelenoverlaposorgroworgcolnumwindnewscreenmsflagmodeflagmmovematchlwidthltermlinelastmesglastkeylanguagekillistermhscrollhscrlbarhjumphilighthardtabgmodegflagsfmtleadflickerfillcolfcolexithookexbhookdispundodisphighdisinpdiscmddiagflagdeskcolordebugcwlinecurwindcurwidthcurlinecurcolcurcharcmodecmdhookcfnamecbufnamecbflagsbufhookasaveacountabquickabcapabbellxlateuppertruetrimtimessuppersubtractslowerslesssindexsgreatersequalrndrightreverseornotnegatemodulomklinemkcolmidlowerlesslengthleftisnumindirectgtkgtcgroupgreaterfindexistequalenvdividechrcatcallbxorborbnotbindbandasciiandaddabsabbrev%%No such function as '%s']%%Division by Zero is illegalNo mark %d in this windowenglishMicroEMACS4.00j-EUCVariable to set: %%No such variable as '%s'Value: %track((( <- )))[Macro aborted]Global variable to declare: (((Globally declare Local variable to declare: (((Locally declare ind-32768%sVariable to display: = Variable listCan not display variable list[Building variable list]$----- Global User VariablesDefined in (, ) -----%Function listCan not display function list[Building function list]& [No such function]: []Can not create macroExecute procedure: No such procedureExecute buffer: !endmstore-procedurelocal%%Out of memory during while scan%%!BREAK outside of any !WHILE loopendw%%!ENDWHILE with no preceding !WHILE%%!WHILE with no matching !ENDWHILE%%Out of memory allocating localsArgument: %%Out of Memory during macro execution[Macro aborted]%%Unknown DirectiveOut of memory while storing macro%%Internal While loop error%%No such label%%Macro Failed in < > at line <<<[=track:>>>(e)val exp, (c/x)ommand, (t)rack exp, (^G)abort, exec, stop debugset %track Exp: = [Exp: File to execute: ..cmd%%No such file as %sRead fileInsert fileFind fileView file[Old buffer]Buffer name: []: Cannot create buffer[New file][Reading file]I/O ERROR, OUT OF MEMORY, Read lines]Write file: wAppend file: aNo file nameTruncated file..write it out[Aborted]Narrowed Buffer..write it out[Writing...][Wrote , saved as Name: [No such file][Inserting file]Inserted Directory to show: File ListCan not display file list[Building File List]: add-keymap Key sequence listCannot display key sequences listNo more room for key entries.rbCannot open file for writingError closing fileWrite I/O errorFile read errorSbSfd7d6d5d4d3d2d1d0c7c6c5c4c3c2c1c0vbkeksissosececmclkwK5K4K3K2K1kukrkRkPkNklkLkIkh@7kHkFkEkdkDkCkbkAFAF9F8F7F6F5F4F3F2F1k;k0k9k8k7k6k5k4k3k2k1btUNIXCannot TCGETACannot TCSETA** Horrible read error occured **TERMEnvironment variable TERM not defined!Cannot open termcap fileUnknown terminal type %s!licoScreen size is too small!pcupThis terminal doesn't have enough power to run microEmacs!xsCannot open terminalKEYMAP CLRMAP ** Error reopening terminal device **SHELL/bin/sh![End]@>#w[Cannot write filter file] fltout[Execution failed].// [y/n]? %s%s[%s]: %s: HOME%s%s%s[%s]: %s%s: %s[Completion list]  ^METANL>: [search failed]ISearch: ? Search string too long? command too long%%Out of memory%%Can not insert stringbug: linsert%%Out of memory while overwriting[Kill ring cleared]LOCK ERROR: Lock table fullCannot lock, out of memoryLOCKFile in use by , overide? - [can not get system error message]yank-popyankwrite-messagewrite-filewrap-wordwiden-from-regionview-fileupdate-screenunmark-bufferuniversal-argumentundoundent-regionunbind-keytrim-regiontranspose-charactersstore-proceduresplit-current-windowsourceshrink-windowshow-filesshell-commandset-markset-encryption-keysetselect-buffersearch-reversesearch-forwardscroll-next-upscroll-next-downsave-windowsave-filerunreverse-incremental-searchrestore-windowresize-windowreplace-stringrename-screenremove-markredraw-displayread-filequote-characterquick-exitquery-replace-stringprintprevious-wordprevious-windowprevious-paragraphprevious-pageprevious-linepop-bufferpipe-commandoverwrite-stringopen-linenopnext-wordnext-windownext-paragraphnext-pagenext-linenext-buffernewline-and-indentnewlinenarrow-to-regionname-buffermove-window-upmove-window-downmouse-resize-screenmouse-region-upmouse-region-downmouse-move-upmouse-move-downmouse-movemeta-prefixmacro-to-keylocallist-undoslist-screenslist-bufferskill-to-end-of-linekill-regionkill-paragraphkill-abbrevsinsert-stringinsert-spaceinsert-fileinsert-abbrevsindent-regionincremental-searchi-shellhunt-forwardhunt-backwardhelphandle-tabgrow-windowgoto-matching-fencegoto-markgoto-lineglobalforward-characterfind-screenfind-filefilter-bufferfill-paragraphexit-emacsexecute-programexecute-procedureexecute-named-commandexecute-macroexecute-fileexecute-command-lineexecute-bufferexchange-point-and-markentab-regionend-of-wordend-of-lineend-of-fileend-macrodisplaydetab-regiondescribe-variablesdescribe-keydescribe-functionsdescribe-bindingsdescribe-abbrevsdelete-windowdelete-undosdelete-screendelete-previous-worddelete-previous-characterdelete-other-windowsdelete-next-worddelete-next-characterdelete-modedelete-kill-ringdelete-global-modedelete-bufferdelete-blank-linesdelete-abbrevdefine-abbrevscycle-screenscycle-ringctlx-prefixcount-wordscopy-regionclear-message-lineclear-and-redrawchange-screen-widthchange-screen-sizechange-screen-rowchange-screen-columnchange-file-namecase-word-uppercase-word-lowercase-word-capitalizecase-region-uppercase-region-lowerbuffer-positionbind-to-keybeginning-of-linebeginning-of-filebegin-macrobackward-characteraproposappend-fileadd-modeadd-global-modeadd-abbrevabort-commandABBREVREPASAVECRYPTMAGICOVERVIEWEXACTSPELLCMODEWRAPWCSEVOMYARBWHITELCYANLMAGENTALBLUELYELLOWLGREENLREDGRAYGREYCYANMAGENTABLUEYELLOWGREENREDBLACKERRORTRUEFALSEforcebreakendwhilewhileendmreturngotoendifelseif%%No such variable as '%s'error.cmd[Can not search and goto at the same time!][Bogus goto argument] --- Press any key to Continue ---Arg:Arg: %dArg: 4[Buffers][Screens][Undos]MAIN[Key not bound][Saving %s] Modified buffers exist. Leave anyway%%Macro already active[Start macro]%%Macro not active[End macro][Aborted][Key illegal in VIEW mode][That command is RESTRICTED]SCREENFind Screen: Delete Screen: [No such screen]%%Can't delete current screen[Switched to screen %s]Screen Buffers------ ------- Change screen name to: [Screen name already in use]Line %D/%D Col %d/%d Char %D/%D (%d%%) char = 0x%x%xLine %D/%D Col %d/%d Char %D/%D (%d%%) char = 0x%xGlobal mode to Mode to add: delete: No such mode!Message to write: String to insert: String to overwrite: [region copied]%%This buffer is already narrowed%%Must narrow at least 1 full line[Buffer is narrowed]%%This buffer is not narrowed[Buffer is widened]No mark set in this windowBug: lost markSearch No pattern setNot found Reverse search %%Out of memoryToo many groupsGroup not ended%%mceq: what is %d?%%No characters in character class%%Character class not endedQuery replace Replace with Aborted!(Y)es, (N)o, (!)Do rest, (U)ndo last, (^G)Abort, (.)Abort back, (?)Help: %%Out of memoryEmpty string replaced, stopping.%D substitutionsReplace '' with ''? %%ERROR while deleting Line/Pos REP Type Data -------- --- ---- ---- CMND CPOS DELC DSTR "INSC ISTR REPC Window number out of rangeCan not delete this windowCannot split a %d line window%%Out of memoryOnly one windowImpossible change[No such window exists]%%Screen size out of range%%Screen width out of range%%Column origin out of range%%Row origin out of rangeNo fill column set%%Out of memoryWords %D Chars %D Lines %d Avg chars/word %f@,} } }}|0123456789ABCDEFxph`XLD<4,$؃Ѓă|tld\PH@8,$܂ЂȂxpd`TLD<4, ؁́ā|th`܅ԅ̅ą|tpl`XPH@84,$ ܄Ԅ̄0Mxtplhd`\XTPLHD@<840,($ 0i!,1(2$3 45678 9001(2(3(4(5(6(7(8(9(܎0(؎OԎHЎL̎DȎNĎKV>><CKBVZZFP<V >V|E d d ex@ |rp~~`؁؁0|Ѓhcommandfltinpfltinpfltoutؗc̜0 |@hT<q,onXdgܛgțdgXj , twhp\LH<,l  Ԛ  rWt\tL<TT, ZH3h̙-4dmtT\LPP4P$ QH;Qؘ}̘duxzd(xl`<L@^4,Ժ" !~pЗėe4zx!dTD8T04 8lpPԖlĖlgVlDd8P8D@8ԥ,Ԧpil|Е$yĕ\X@lUpxhP$KD4l( ej HKܔj̔4kQZkhpi`:P,8@8<( wPg` QГ,\?l xSddTD8 h$@k \eH mainxph`XPH@84,UG[[Q؝Нȝz0 ph`XPH@4,$mmm0m1apbPelfl1AB0CD EdF(GHIJ8KLXjM8NԥO|P\QlR,8S:TUdVԦW!XpYZX[l\:^l_SAcBCdDETFdIeK8LM NgO PVR eSZTUV hW\eXZ`\Z?h!w@$y#xz$}=@( )<D>@^^ 0 Z1W2,\AB8C~EG4KMNXdOpiPlURSpUTWjX@YZ^CwEQFG<HtKlLjM NR$KS QVhUTTW4zXPYZi\ Q ?Ժ!j)( .><~ABxCqDrEFlGKLoMNP@QuRHKUnVXW, XH;YZB@C@HD@F@N@R@"S@!<P\ZXB0LjF(>NԥVԦCD B xF lZ @V ?Addddddddddddddddddddddddddddddddddddddddddddddddddddddd L {0  @d0o4ooGCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.3 20010315 (release).symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.ctors.dtors.got.dynamic.sbss.bss.comment# 100\7  ?Go To44 0c dd l ll (u   ~LLdd{{*&&0@@@@@@AA|BBBBlmB G